PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G058800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family WRKY
Protein Properties Length: 161aa    MW: 18342.7 Da    PI: 10.0518
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G058800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.84.5e-3383141159
                         ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ +v++tYeg+H h+
  Potri.001G058800.1  83 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEGIVVTTYEGTHSHQ 141
                         59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.0E-3468141IPR003657WRKY domain
SuperFamilySSF1182909.55E-3075142IPR003657WRKY domain
PROSITE profilePS5081129.75778143IPR003657WRKY domain
SMARTSM007744.1E-3883142IPR003657WRKY domain
PfamPF031061.0E-2684141IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MSLNMVPNSY ASTDLEGAKG NGFLGLMQEM EAPAASLNVD NISQNRGFVG SITSEGRLEK  60
KRGEKKIRKP KYAFQTRSQV DILDDGYRWR KYGQKAVKNN KFPRSYYRCT HQGCNVKKQV  120
QRLTKDEGIV VTTYEGTHSH QIEKSTDNFE HILRQMQIYS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A9e-2973142776Probable WRKY transcription factor 4
1wj2_A9e-2973142776Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011036106.11e-114PREDICTED: probable WRKY transcription factor 75
SwissprotQ9FYA27e-56WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLB9GVW04e-97B9GVW0_POPTR; Uncharacterized protein
STRINGPOPTR_0003s16750.11e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.19e-57WRKY DNA-binding protein 75